Research Benefits Stimulates the release of natural growth hormone Supports muscle growth Enhances mood and resilience to stress Slows the aging process Boosts metabolic rate Enhances sleep quality Supports a balanced inflammatory response Improves bone density Additional Info Properties Tesamorelin Chemical Formula: C223H370N72O69S Ipamorelin Chemical Formula: C38H49N9O5 Tesamorelin Molecular Weight: 5195.908 g/mol Ipamorelin Molecular Weight: 711.868 g/mol Tesamorelin Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Ipamorelin Sequence: Aib-His-D-2Nal-D-Phe-Lys Total Amount of the Active Ingredient: 8mg (1 vial) Shelf Life: 36 months Shipping USA Canada Seizure Policy (International Orders): If your shipment is seized, we offer a 50% discount on your next purchase
Just be mindful of your toppings, said Maples, who told INSIDER that "when you could easily eat a whole day's worth of calories in one meal, choose a short stack of pancakes instead, to replace carbohydrates
Its approval means it has undergone Phase 3 clinical trials, FDA safety review, and ongoing post-market surveillance
February 27, 2026 HHS Secretary publicly stated intent to broaden peptide access
IGF-1 LR3 is prohibited at all times by the World Anti-Doping Agency (WADA) and by all major professional sports organizations
Support for anti-aging and skin health is another reason many people explore this therapy
